Amriet ImpThis supplier has not provided a Company Introduction yet..Address:Beuno Vista Ave YonkersProduct/Service:Rice, Dog Food, animal feed, concentraat, cron , bird food and toys,animal feed,pet food,,Rice, Dog Food, animal feed, concentraat, cron , bird food and toys,animal feed,pet food,Rebecha HermanThis supplier has not provided a Company Introduction yet..Address:6941 Windwood TrailProduct/Service:Pet Clothes,Pet Food,Pet Toys,Animal Housing,Animal Grooming Supplies ,,Pet Clothes,Pet Food,Pet Toys,Animal Housing,Animal Grooming Supplies ,K P IndustriesThis supplier has not provided a Company Introduction yet..Address:233 Wallace WayProduct/Service:Animal Enclosure,Fence Panels , KPI-105 animal cage,ChopSaw,,Animal Enclosure,Fence Panels , KPI-105 animal cage,ChopSaw,Gary's WildlifeThis supplier has not provided a Company Introduction yet..Address:331 W Grove St Suitte 2Product/Service:Animal Control,Pest Removal,Bat Removal , Animal Control|Pest Removal,,Animal Control,Pest Removal,Bat Removal , Animal Control|Pest Removal,Dreamwalker EnterprisesWe are a home based business specializing metaphysical and wiccan items; wish stones, worry our newest product, new concept in runes. looking to expand market present interested buyers unique handcrafted quality products. ....Address:854 county road 3592Product/Service:Wish Stones, Worry Wish Stones and Animal Spirit Runes , Animal Spirt Runes,WISH STONES,stone,stone,stone,stone,stone,stone,,Wish Stones, Worry Wish Stones and Animal Spirit Runes , Animal Spirt Runes,WISH STONES,stone,stone,stone,stone,stone,stone,Beyond Enchanted Gifts & Home DecorBeyond Enchanted Products offers over hundreds of realistic hand painted animal figurines: Dogs, cats, horses, wildlife, jungle animals, nautical, rocky mountain animals. Each figurine is painted, durable, washable sculpted from resin drystone or sandicast. Products: Life-size dog statues, ....Address:1221 Toole Ave # GProduct/Service:High quality hand painted realistic animal statues, figurines, magnets, dog statues: Horses, cats, nautical, wildlife, bears, panthers, cougars, tigers, jaguars, coyotes, wolves, and more. , Life-size Yellow Labrador Lab Puppy Statue,Medium Size Indoor Outdoor Doberman Dog Statues,Desktop Size Realistic Hand Painted Panda Figurines,Desktop Size Deer Stag Statue on Natural Base,Small Realistic Hand Painted Animal Figurines,,High quality hand painted realistic animal statues, figurines, magnets, dog statues: Horses, cats, nautical, wildlife, bears, panthers, cougars, tigers, jaguars, coyotes, wolves, and more. , Life-size Yellow Labrador Lab Puppy Statue,Medium Size Indoor Outdoor Doberman Dog Statues,Desktop Size Realistic Hand Painted Panda Figurines,Desktop Size Deer Stag Statue on Natural Base,Small Realistic Hand Painted Animal Figurines,KING PROSPER (USA) CORPWe are a Supplier / Exporter of Soybean Meal for Animal Feed and Cooking Oil Human, Soybeans ( whole grain ), all our products USA origin, the best quality, reasonable price on time delivery policy, we welcome valuable buyer from over world to contact with us directly set up long business cooperation. ....Address:26 Plains Gap Road,Product/Service:Soybean Meal for Animal Feed,Soybean Oil for Human,Soybeans , Edible Soybean Oil for Cooking,HIGH PROTEIN SOYBEANS ( whole grain ),Soybean Meal for Animal Feed,,Soybean Meal for Animal Feed,Soybean Oil for Human,Soybeans , Edible Soybean Oil for Cooking,HIGH PROTEIN SOYBEANS ( whole grain ),Soybean Meal for Animal Feed,Royal Lion TransportationThis supplier has not provided a Company Introduction yet..Address:P. O Box 4623Product/Service:Animal Feed , Animal Feed,,Animal Feed , Animal Feed,Wintershall-De MerchantsThis supplier has not provided a Company Introduction yet..Address:511 Sydney Walk laneProduct/Service:Plants and Animal Oils,Cooking oils,Crude Oils,Refined White Sugar,Indian and Brazil Refined White Sugar , Plant and Animal oils,,Plants and Animal Oils,Cooking oils,Crude Oils,Refined White Sugar,Indian and Brazil Refined White Sugar , Plant and Animal oils,CREDIBLE IMPORTS & EXPORTS, INCPlease send your details requirements. We can supply. Give me telephone numbers. Thank you. Dr. Mohsin Ali, PresidentCredible Imports & Exports, Inc652 Vernon AvenueEast Meadow, NY 11554172-11 Hillside AvenueJamaica, 11432USATel: (516) 804-2800; (718) 278-8181; 278-7845Cell / Mobile: (631) ....Address:652 Vernon AvenueProduct/Service:Rice, Wheat, Cooking Oil, Urea, Powder Milk, Corn, Animal Feeds, Barley, Power Tiller, Tractors, Used Rails, Scrap Metals, HMS 1 & 2, D2, Cement, Ready Made Garments, Knit Wear, Coal, JP 54, M100 , SPORT WEAR,BABIES WEAR,KNIT WEAR,UNDERWEAR,MEN'S WEAR,WOMEN'S WEAR,WINTER GARMENT,CHILDREN'S WEAR,Animal Feeds,FAT AND NON-FAT SUGAR,SKIMMED SUGAR,POWDER MILK,BEAT SUGAR,CANE SUGAR,SUNFLOWER OIL,CANOLA OIL,CORN OIL,VEGETABLE OIL,PALM OIL,SOY BEAN OIL,MAIZE,OATS,WHEAT FLOUR,Red Hard Winter Wheat G2,Durum Wheat G2,Feed Yellow Corn,Feed Barley,Soft White Wheat,Durum Wheat,Soft Red Wheat,Red Hard Winter Wheat,D2, M100 and JP 54,,Rice, Wheat, Cooking Oil, Urea, Powder Milk, Corn, Animal Feeds, Barley, Power Tiller, Tractors, Used Rails, Scrap Metals, HMS 1 & 2, D2, Cement, Ready Made Garments, Knit Wear, Coal, JP 54, M100 , SPORT WEAR,BABIES WEAR,KNIT WEAR,UNDERWEAR,MEN'S WEAR,WOMEN'S WEAR,WINTER GARMENT,CHILDREN'S WEAR,Animal Feeds,FAT AND NON-FAT SUGAR,SKIMMED SUGAR,POWDER MILK,BEAT SUGAR,CANE SUGAR,SUNFLOWER OIL,CANOLA OIL,CORN OIL,VEGETABLE OIL,PALM OIL,SOY BEAN OIL,MAIZE,OATS,WHEAT FLOUR,Red Hard Winter Wheat G2,Durum Wheat G2,Feed Yellow Corn,Feed Barley,Soft White Wheat,Durum Wheat,Soft Red Wheat,Red Hard Winter Wheat,D2, M100 and JP 54,American Health & Medical Supply International Corp.This supplier has not provided a Company Introduction yet..Address:35 Weaver StreetProduct/Service:Medical Research Equipment, Alzet OSMOTIC PUMPS, Animal Pacer, Patch Clamp amplifier, CWE Instruments for physiology respiration, TiVi600 Tissue Viability Imager, Bertin Precellys 24, Laser Scanning Cytometer, Hatteras Instruments, Pinnacle Technology, Data Acquisition and Analysis, Cell Microcontrols, PE10 PE50 PE60 Tubing, Wire Myograph, Pressure Myograph, VitalView Telemetric, SCIREQ Scientific Respiratory Equipment, Ultra Miniature PV Pressure VolumeCatheters, PPS Silent Surfactant, LABORAS SONOTRACK, , Patch Clamp amplifier,PE10 PE 50 PE 60 Tubing,MAG-10 Mountain Air Generator,Animal Pacer,NO Dopamin PO2 MONITOR,,Medical Research Equipment, Alzet OSMOTIC PUMPS, Animal Pacer, Patch Clamp amplifier, CWE Instruments for physiology respiration, TiVi600 Tissue Viability Imager, Bertin Precellys 24, Laser Scanning Cytometer, Hatteras Instruments, Pinnacle Technology, Data Acquisition and Analysis, Cell Microcontrols, PE10 PE50 PE60 Tubing, Wire Myograph, Pressure Myograph, VitalView Telemetric, SCIREQ Scientific Respiratory Equipment, Ultra Miniature PV Pressure VolumeCatheters, PPS Silent Surfactant, LABORAS SONOTRACK, , Patch Clamp amplifier,PE10 PE 50 PE 60 Tubing,MAG-10 Mountain Air Generator,Animal Pacer,NO Dopamin PO2 MONITOR,Roberrt NebelThis supplier has not provided a Company Introduction yet..Address:147-A Santa Clara St.Product/Service:Bulk Food s,Sugar,Orange juice,Animal feeds,Cement , White Pure Cane Sugar,Food and animal feeds,,Bulk Food s,Sugar,Orange juice,Animal feeds,Cement , White Pure Cane Sugar,Food and animal feeds,Olympic Adhesives Inc.This supplier has not provided a Company Introduction yet..Address:670 Canton StreetProduct/Service:Jelly Glue,Animal Glue,Casemaking Glue,Bookbinding Glue,Lever Arch File Glue,Rigid Box Glue,Horauf Glue,Kolbus Glue,Emmeci Glue,Crathern Glue,Peroni Glue,Potdevin Glue , Jelly Glue (animal glue) Adhesives,,Jelly Glue,Animal Glue,Casemaking Glue,Bookbinding Glue,Lever Arch File Glue,Rigid Box Glue,Horauf Glue,Kolbus Glue,Emmeci Glue,Crathern Glue,Peroni Glue,Potdevin Glue , Jelly Glue (animal glue) Adhesives,Vet Effects - Animal ManikinsVET EFFECTS- ANIMAL MANIKINS.Address:146 W. Cypress Ave. Unit# 101Product/Service:CPR Canine Training Manikin (Item #2002),Animal Manikins,Manikins , Animal Mannequins,CPR Canine Training Manikin,(Item #2003),Neuter Training Manikin,Spay Trainiing Manikin,Intubation Training Manikin (Item #2006),,CPR Canine Training Manikin (Item #2002),Animal Manikins,Manikins , Animal Mannequins,CPR Canine Training Manikin,(Item #2003),Neuter Training Manikin,Spay Trainiing Manikin,Intubation Training Manikin (Item #2006),Higher Ground Energy Solutions, Incwddkhfeikncwoihiwhiinifknidsancidnirenkvniriwidekfmfnfjfjfjfjfkdddmdmjejejenemelldkfjffnremememjfjfjfjmnfnrerjekjkfkfmrfnrenrejf.Address:602 sweetwater ave, florence, alabama, USAProduct/Service:plush toys, cullet, animal fats, feedstocks, bio-diesel,,plush toys, cullet, animal fats, feedstocks, bio-diesel,Stuffable BuddiesIndependent Representative of CJ Critter Club along with many other products including but not limited to DVDs, CDs, Software and books. Established in 2006 added as a product line 2007. We also sell on the online auction venues Ebay Yahoo. ....Address:16419 E Cogan Rd, Independence, MO, USAProduct/Service:unstuffed animal skins, clothing, accessories,dolls,Oversize unstuffed Rottweiler kit,,unstuffed animal skins, clothing, accessories,dolls,Oversize unstuffed Rottweiler kit,Quantum Opticswe of quantum optics have been researching lasers since 1998 and an arrary laser products available. as a registered business in los angeles california must collect 9% sales tax. everything from surgical lasers, to pointers , high energy gun sights ect. all discriminating quality functionality ....Address:830 1/2 s. olive st, los angeles, california, USAProduct/Service:surgical lasers for animal use,Veternary surgical lasers,,surgical lasers for animal use,Veternary surgical lasers,Bomac Vets-Plus IncBomac Vets Plus is an animal feed supplement company. It specializes in animal nutritional products..Address:102 3rd Ave, Knapp, WI, USAProduct/Service:animal nutritional supplements,,animal nutritional supplements,US Natural Nutrients And Minerals, Inc.Our company owns the mining rights to 960 acres of lucustrine lake bed deposits that are a very special form Calcium Montmorillonite. It contains over 78 naturally chealated nutrients and minerals. has vast restorative powers for health growth all life including flora fauna. We market it under our trade ....Address:42725 Glass Drive, Indio, California, USAProduct/Service:excelerite natuaral soil rejuvenator, micro excelerite capsules for humans, excelerite for animal health and growth,,excelerite natuaral soil rejuvenator, micro excelerite capsules for humans, excelerite for animal health and growth,Infinitely SweetThis supplier has not provided a Company Introduction yet..Address:3619 Stubai TrailProduct/Service:children's clothing,animal print baby bodysuits,polka dot baby bodysuits,argyle baby bodysuits,childrens tshirts ,,children's clothing,animal print baby bodysuits,polka dot baby bodysuits,argyle baby bodysuits,childrens tshirts ,
Recently Updated
Shenzhen Yifan Founder Electronics Co., Ltd JF KOREA Co., Ltd. In Home Lighting Enterprise Jining Xintong Environment Protection Packaging... Binzhou Sunshien Wpc Co.,Ltd Allink Technology Co., Ltd Shanghai Eversuccess CO;LTD Nickel Platform Shaoxing Haitech Medical Products Co., Ltd. Wuxi Zhongde Plastic Co., Ltd. Bobbie's Baskets Xiamen Hui Ye Photoelectric Technology Co., Ltd. Shenzhen MYKIND Tech Co., Ltd Guiping Chenyu Sportswear Manufacturing Factory HONG KONG Tamp Industry Co., Ltd Easygo International Indstry (china)co.ltd Home Beautiful - Decorating Ideas For You Home Sahyadri Enterprices KUN YOU Phar Co.,LTD. Wenzhou Zigpac Industry Co.,Ltd.